PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA00g74270
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family NF-YA
Protein Properties Length: 161aa    MW: 17826.1 Da    PI: 11.1304
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA00g74270genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA104.59.2e-332278158
   CBFB_NFYA  1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58
                d p+YVNaKQy++Il+RRq Rakle+++kl  k+rkpylheSRh hA++R RgsgGrF
  CA00g74270 22 DGPIYVNAKQYHGILRRRQIRAKLEAQNKL-VKNRKPYLHESRHLHAVNRVRGSGGRF 78
                57****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005211.1E-352081IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115235.7982181IPR001289Nuclear transcription factor Y subunit A
PfamPF020453.8E-282478IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006165.0E-242446IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS0068602646IPR018362CCAAT-binding factor, conserved site
PRINTSPR006165.0E-245578IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 161 aa     Download sequence    Send to blast
MQPQMMGIAP ARVPLPVDIA EDGPIYVNAK QYHGILRRRQ IRAKLEAQNK LVKNRKPYLH  60
ESRHLHAVNR VRGSGGRFLS SKKALQSDPN SYPANSTSSR DSVEHEGSTS AFSSVRQDVI  120
HNGISFQQQQ QPDQMAFSVS SHMGINMQGN GTQQRAPVVR *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A1e-222283263NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016540349.11e-113PREDICTED: nuclear transcription factor Y subunit A-4-like
RefseqXP_016540350.11e-113PREDICTED: nuclear transcription factor Y subunit A-4-like
RefseqXP_016540351.11e-113PREDICTED: nuclear transcription factor Y subunit A-4-like
SwissprotQ9SYH41e-38NFYA5_ARATH; Nuclear transcription factor Y subunit A-5
TrEMBLK4DBZ31e-101K4DBZ3_SOLLC; Uncharacterized protein
STRINGSolyc12g009050.1.11e-101(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA50092338
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G54160.17e-40nuclear factor Y, subunit A5